Loading...
Statistics
Advertisement

LifeCo Unltd South Africa
www.lcu-sa.biz/
The LifeCo UnLtd South Africa (LCU-SA) is a replicable social business and is owned and governed by a charitable trust.

Lcu-sa.biz

Advertisement
Conversion Technology Metas Server
Lcu-sa.biz is hosted in Germany / Nürnberg . Lcu-sa.biz uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Google Font API, Html, Number of used javascripts: 12. First javascripts: Jquery.min.js, Jquery-ui.min.js, Jquery.fullPage.min.js, Number of used analytics tools: 1. First analytics tools: Google Tagmanager, Its server type is: Apache.

Technologies in use by Lcu-sa.biz

Technology

Number of occurences: 9
  • CSS
  • Google Font API
  • Html
  • Html5
  • Iframe
  • Javascript
  • jQuery Fancybox
  • jQuery UI
  • Php

Advertisement

Javascripts

Number of occurences: 12
  • jquery.min.js
  • jquery-ui.min.js
  • jquery.fullPage.min.js
  • examples.js
  • SpryValidationTextField.js
  • SpryValidationTextarea.js
  • jquery.slimscroll.min.js
  • jquery-1.10.2.min.js
  • jquery.fancybox.js
  • unslider.js
  • api.js

Analytics

Number of occurences: 1
  • Google Tagmanager

Server Type

  • Apache

Powered by

  • PHP/5.6.25-1~dotdeb.7.1

Google Tag Manager ID

  • GTM-WCKXNS

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Lcu-sa.biz

SSL certificate

    • name: /CN=*.nur4.host-h.net
    • subject:
      • CN: *.nur4.host-h.net
    • hash: bc5a0d41
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: RapidSSL SHA256 CA - G2
    • version: 2
    • serialNumber: 105278955733896382424800095834521090116
    • validFrom: 160408000000Z
    • validTo: 180708235959Z
    • validFrom_time_t: 1460073600
    • validTo_time_t: 1531094399
    • extensions:
      • subjectAltName: DNS:*.nur4.host-h.net
      • basicConstraints: CA:FALSE
      • crlDistributionPoints: Full Name: URI:http://gs.symcb.com/gs.crl
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal User Notice: Explicit Text: https://www.rapidssl.com/legal
      • authorityKeyIdentifier: keyid:4C:F4:BF:E8:3B:BE:C2:24:F3:1B:47:3B:B5:6E:48:8E:16:AB:AF:12
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • authorityInfoAccess: OCSP - URI:http://gs.symcd.com CA Issuers - URI:http://gs.symcb.com/gs.crt
      • 1.3.6.1.4.1.11129.2.4.2: ‚jhvÝë+z O¦ ‹­hp~.ŽÕ\ˆ=ÄͶì¾ÌSõ™Ñ=G0E!éçR‘v×üà”âPû­€û”¢™!çïãŠQ(ÿ› =±—~¹›Ûîžxjäºs2'9.\f®) ª_p·¶tv¤¹ ´X‡»¢Ìgp <5˜ù߸ãwÍÈ ÜSõ™ÑwG0E ~)—. ¼Õ·Ãª<¦'§1IeÑ¢NLT»[4‘Ü-!ρ#F¸b%ð㎞~}²ÓL¼•H1o¥Q”HҐj*°!vhö˜ød‚¾:Œî¹(LüqQ]g“ÔDÑ g¬»OOûÄSõ™Ñ}G0E õhQ^Á󔀽¹;/72BQ#&° ÆÍ€q‹¥:q!ØDb-ç0J—?ZNÙ>›h2âp-ú÷bŸ:Šycø

Meta - Lcu-sa.biz

Number of occurences: 9
  • Name:
    Content: http://www.lcu-sa.com/images/dandelion.jpg
  • Name: author
    Content: LifeCo Unltd
  • Name: description
    Content: The LifeCo UnLtd South Africa (LCU-SA) is a replicable social business and is owned and governed by a charitable trust.
  • Name: keywords
    Content: life,lifeco,co,life-co,college,unltd,social,entrepreneur,entrepreneurship,pat,pillai,responsibility,csr
  • Name: Resource-type
    Content: Document
  • Name: twitter:card
    Content: summary
  • Name: twitter:description
    Content: LifeCo UnLtd South Africa is a replicable social business and is owned and governed by a charitable trust. The group employs business principles for social impact. Life College Group (founded in 1997) has merged with UnLtd South Africa (founded in 2011). LifeCo Unltd SA as a group exists for society’s benefit and distributes 100% of its net proceeds and declared dividends to society.
  • Name: twitter:title
    Content: LifeCo Unltd South Africa
  • Name: twitter:domain
    Content: LifeCo Unltd South Africa

Server / Hosting

  • IP: 213.133.106.190
  • Latitude: 49.45
  • Longitude: 11.07
  • Country: Germany
  • City: Nürnberg

Rname

  • ns1.your-server.de
  • ns3.second-ns.de
  • ns.second-ns.com
  • mail.lcu-sa.biz

Target

  • postmaster.your-server.co.za

HTTP Header Response

HTTP/1.1 200 OK Date: Wed, 24 Aug 2016 03:01:22 GMT Server: Apache X-Powered-By: PHP/5.6.25-1~dotdeb.7.1 Vary: Accept-Encoding Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Transfer-Encoding: chunked Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

DNS

host: lcu-sa.biz
  1. class: IN
  2. ttl: 7200
  3. type: A
  4. ip: 213.133.106.190
host: lcu-sa.biz
  1. class: IN
  2. ttl: 7200
  3. type: NS
  4. target: ns1.your-server.de
host: lcu-sa.biz
  1. class: IN
  2. ttl: 7200
  3. type: NS
  4. target: ns3.second-ns.de
host: lcu-sa.biz
  1. class: IN
  2. ttl: 7200
  3. type: NS
  4. target: ns.second-ns.com
host: lcu-sa.biz
  1. class: IN
  2. ttl: 7200
  3. type: SOA
  4. mname: ns1a.your-server.co.za
  5. rname: postmaster.your-server.co.za
  6. serial: 2014101401
  7. refresh: 86400
  8. retry: 1800
  9. expire: 3600000
  10. minimum-ttl: 86400
host: lcu-sa.biz
  1. class: IN
  2. ttl: 7200
  3. type: MX
  4. pri: 10
  5. target: mail.lcu-sa.biz

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.cu-sa.biz, www.lucu-sa.biz, www.ucu-sa.biz, www.l8cu-sa.biz, www.8cu-sa.biz, www.l9cu-sa.biz, www.9cu-sa.biz, www.ljcu-sa.biz, www.jcu-sa.biz, www.l0cu-sa.biz, www.0cu-sa.biz, www.lmcu-sa.biz, www.mcu-sa.biz, www.lpcu-sa.biz, www.pcu-sa.biz, www.locu-sa.biz, www.ocu-sa.biz, www.lu-sa.biz, www.lcdu-sa.biz, www.ldu-sa.biz, www.lcru-sa.biz, www.lru-sa.biz, www.lctu-sa.biz, www.ltu-sa.biz, www.lcvu-sa.biz, www.lvu-sa.biz, www.lcfu-sa.biz, www.lfu-sa.biz, www.lcgu-sa.biz, www.lgu-sa.biz, www.lchu-sa.biz, www.lhu-sa.biz, www.lcnu-sa.biz, www.lnu-sa.biz, www.lcmu-sa.biz, www.lmu-sa.biz, www.lcju-sa.biz, www.lju-sa.biz, www.lc-sa.biz, www.lcuw-sa.biz, www.lcw-sa.biz, www.lcue-sa.biz, www.lce-sa.biz, www.lcus-sa.biz, www.lcs-sa.biz, www.lcua-sa.biz, www.lca-sa.biz, www.lcusa.biz, www.lcu-tsa.biz, www.lcutsa.biz, www.lcu-gsa.biz, www.lcugsa.biz, www.lcu-hsa.biz, www.lcuhsa.biz, www.lcu-usa.biz, www.lcuusa.biz, www.lcu-jsa.biz, www.lcujsa.biz, www.lcu-xsa.biz, www.lcuxsa.biz, www.lcu-ssa.biz, www.lcussa.biz, www.lcu-asa.biz, www.lcuasa.biz, www.lcu-sa.biz, www.lcusa.biz, www.lcu- sa.biz, www.lcu sa.biz, www.lcu-a.biz, www.lcu-sea.biz, www.lcu-ea.biz, www.lcu-swa.biz, www.lcu-wa.biz, www.lcu-sda.biz, www.lcu-da.biz, www.lcu-sxa.biz, www.lcu-xa.biz, www.lcu-sfa.biz, www.lcu-fa.biz, www.lcu-sga.biz, www.lcu-ga.biz, www.lcu-sta.biz, www.lcu-ta.biz, www.lcu-s.biz, www.lcu-sao.biz, www.lcu-so.biz, www.lcu-sap.biz, www.lcu-sp.biz, www.lcu-sa9.biz, www.lcu-s9.biz, www.lcu-sa.biz, www.lcu-s.biz, www.lcu-sai.biz, www.lcu-si.biz, www.lcu-sau.biz, www.lcu-su.biz,

Other websites we recently analyzed

  1. Clean Meals - Hoe gezond eet jij?
    Wij hebben de oplossing als je makkelijk en gezond wil eten: Clean Meals, heerlijke ready-made maaltijden in optimale samenstelling qua voedingswaarden.
    United Kingdom - 78.136.17.171
    G Analytics ID: UA-72057542-1
    Server software:
    Technology: BootstrapCDN, CSS, Datepicker, Flexslider, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, jQuery, jQuery UI, Php, Pingback, Revslider, SVG, Google Analytics, Google Tagmanager, Visual Website Optimizer, Wordpress
    Number of Javascript: 35
    Number of meta tags: 9
  2. Lovely Jane macht Pause
    Germany - 85.13.136.199
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  3. huntingfishingcampinggearreviews.com
    Houston (United States) - 192.185.4.67
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 2
  4. wherefarminggrows.com
    Scottsdale (United States) - 184.168.221.36
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  5. Britta Mangold . director of photography
    Dies ist die private Webseite von Britta Mangold
    Germany - 82.165.58.15
    Server software: Apache/1.3.33 (Debian GNU/Linux) FrontPage/5.0.2.2635 DAV/1.0.3 mod_python/2.7.10 Python/2.3.4 mod_gzip/1.3.26.1a PHP/4.3.10-18 mod_ssl/2.8.22 OpenSSL/0.9.7e mod_perl/1.29 mod_chroot/0.4
    Technology: CSS, Html, Javascript
    Number of Javascript: 5
    Number of meta tags: 4
  6. certifymybiz.com
    Scottsdale (United States) - 184.168.221.37
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  7. hajarbuncit.com
    Singapore (Singapore) - 54.251.110.33
    Server software: nginx/1.6.2
    Technology: Html
  8. ACKERMANN Hausverwaltung in München - Immobilienmanagement seit 1919
    Die Ackermann Hausverwaltung in München leistet die Verwaltung von Mietshäusern und Wohneigentum, bietet Asset Management, Projektentwicklung sowie Verkauf und Vermietung von Immobilien.
    Germany - 46.252.18.246
    G Analytics ID: UA-56769375-6
    Server software: Apache/2.4.10
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 14
    Number of meta tags: 4
  9. *** HOTEL GORROPU, SARDINIA *** – Book Hotel Gorropu online with discount
    Hotel Gorropu, overview, photos, location, rooms and rates, services and facilities, cheap rates reservation
    Herndon (United States) - 209.8.46.75
    Server software: nginx
    Technology: CSS, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 4
  10. 上海皋航实业有限公司
    Shanghai (China) - 222.73.44.242
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Swf Object
    Number of meta tags: 1

Check Other Websites